PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34410.1
Common NameARF21, F12K21.26, F7P12.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 606aa    MW: 68778.7 Da    PI: 8.5099
Description auxin response factor 21
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34410.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.21.4e-22126227199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f kvlt sd+++ g +++pkk+a e+     ++++   +++   d++ ++W+++++yr++++r+ lt+GW+eF  +++L  gD++vF   + +++el+
  AT1G34410.1 126 FTKVLTASDTSAYGGFSVPKKHAIEClppldMSQPLPAQEILAIDLHDNQWRFRHNYRGTPQRHSLTTGWNEFITSKKLVKGDVIVFV--RGETGELR 221
                  89****************************9666666779************************************************..449999** PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  v+++r+
  AT1G34410.1 222 VGIRRA 227
                  ****97 PP

2Auxin_resp981.4e-32252331183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a ha++++++F vvY+Pr+  s+F+v+++k+++a+++k+ vG+Rf m+fe++d+serr+ Gt++gvsd++p +W+ S+WrsL+
  AT1G34410.1 252 AKHAFDNQCIFIVVYKPRS--SQFIVSYDKFLDAVNNKFNVGSRFTMRFEGDDFSERRYFGTIIGVSDFSP-HWKCSEWRSLE 331
                  6899**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.4E-37117238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.44E-30123247IPR015300DNA-binding pseudobarrel domain
CDDcd100173.55E-21125226No hitNo description
SMARTSM010192.5E-21126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.957126228IPR003340B3 DNA binding domain
PfamPF023622.0E-19126227IPR003340B3 DNA binding domain
PfamPF065074.2E-28252330IPR010525Auxin response factor
PfamPF023091.2E-6508547IPR033389AUX/IAA domain
SuperFamilySSF542771.37E-9509587No hitNo description
PROSITE profilePS5174524.846511592IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MESGNIVNAQ PKLSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGENVYYFP QGNIELVQAS  60
TREELNELQP ICDLPSKLQC RVIAIHLKVE NNSDEIYAEI TLMPDTTQVV IPTQSENRFR  120
PLVNSFTKVL TASDTSAYGG FSVPKKHAIE CLPPLDMSQP LPAQEILAID LHDNQWRFRH  180
NYRGTPQRHS LTTGWNEFIT SKKLVKGDVI VFVRGETGEL RVGIRRARHQ QGNIPSSIVS  240
IDCMRHGVIA SAKHAFDNQC IFIVVYKPRS SQFIVSYDKF LDAVNNKFNV GSRFTMRFEG  300
DDFSERRYFG TIIGVSDFSP HWKCSEWRSL EVQWDEFASF SRPNKVSPWE IEHLVPALNV  360
PRSSLLKNKR LREVNEFGSS SSHLLPPILT QGQEIGQLSV ASPMNISLRY RDTTEAAMNP  420
SRLLMSYPVQ PMPKLNYNNQ MVTQIEENIT TKAGTNFRLF GVTLDTPPMI KDPIKQIGSD  480
ISKLTERKKF GQSQTLRSPI EIQSKQFSSS RTCTKVQMQG VTIGRAVDLS VLNGYDQLIL  540
ELEKLFDIKG QLQTRNQWKI AFTDSDGYEM LVGDDPWPEF CKMVKKILIY SKEEVKNLKS  600
SKSLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-12013541355Auxin response factor 1
4ldw_A1e-12013541355Auxin response factor 1
4ldw_B1e-12013541355Auxin response factor 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425625220.0
Genevisible261163_x_at0.0
Expression AtlasAT1G34410-
AtGenExpressAT1G34410-
ATTED-IIAT1G34410-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6697960.0AY669796.1 Arabidopsis thaliana clone C105354 ARF22 (At1g34390) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174701.20.0auxin response factor 21
SwissprotQ9C8N90.0ARFU_ARATH; Putative auxin response factor 21
TrEMBLC0SUZ10.0C0SUZ1_ARATH; Auxin response factor (Fragment)
STRINGAT1G34410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Representative plantOGRP5261578
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hagen G,Guilfoyle T
    Auxin-responsive gene expression: genes, promoters and regulatory factors.
    Plant Mol. Biol., 2002 Jun-Jul. 49(3-4): p. 373-85
    [PMID:12036261]
  3. Remington DL,Vision TJ,Guilfoyle TJ,Reed JW
    Contrasting modes of diversification in the Aux/IAA and ARF gene families.
    Plant Physiol., 2004. 135(3): p. 1738-52
    [PMID:15247399]
  4. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  5. Axtell MJ,Snyder JA,Bartel DP
    Common functions for diverse small RNAs of land plants.
    Plant Cell, 2007. 19(6): p. 1750-69
    [PMID:17601824]
  6. Gifford ML,Dean A,Gutierrez RA,Coruzzi GM,Birnbaum KD
    Cell-specific nitrogen responses mediate developmental plasticity.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(2): p. 803-8
    [PMID:18180456]
  7. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  8. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  9. Varaud E, et al.
    AUXIN RESPONSE FACTOR8 regulates Arabidopsis petal growth by interacting with the bHLH transcription factor BIGPETALp.
    Plant Cell, 2011. 23(3): p. 973-83
    [PMID:21421811]